PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 114aa    MW: 13137 Da    PI: 6.5631
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776067.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.93.5e-15349450
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    e++ n++ t+  R++ i  K  ELS+LCd++ + ii s++g+l++++
  XP_009776067.1  3 EENQNKKKTYQVRKECIKRKTMELSTLCDIKCCTIITSPQGELQTWP 49
                    67889999**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.876148IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-15371IPR002100Transcription factor, MADS-box
PfamPF003191.0E-10348IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MAEENQNKKK TYQVRKECIK RKTMELSTLC DIKCCTIITS PQGELQTWPE NLDAVKQVLN  60
LYTKTLSPNK KANEELSEEE IDILTLVESK LDAVNNRIRY LENKNAGFVS NNKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776067.15e-78PREDICTED: MADS-box transcription factor 56-like
RefseqXP_016469068.15e-78PREDICTED: agamous-like MADS-box protein AGL81
TrEMBLM1D6N02e-44M1D6N0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000831727e-44(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37231639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26880.12e-11AGAMOUS-like 26